PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0740s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 279aa    MW: 31712.1 Da    PI: 7.8955
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0740s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.26.6e-5381321128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeelv +yL++k++++++ +  +i+evd+yk++PwdLp ++  +ekewyfF++rd+ky++g+r+nra+ +gyWkatg
  SapurV1A.0740s0040.1.p   8 LPPGFRFHPTDEELVLHYLCRKCTSQSIAV-PIIAEVDLYKFDPWDLPGMALYGEKEWYFFTPRDRKYPNGSRPNRAAGRGYWKATG 93 
                             79*************************999.88***************6666689******************************** PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              dk++ +   ++vg+kk Lvfy g+apkgekt+W+mheyrl
  SapurV1A.0740s0040.1.p  94 ADKPIGQ--PKTVGIKKALVFYAGKAPKGEKTNWIMHEYRL 132
                             *****98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-624158IPR003441NAC domain
PROSITE profilePS5100559.9278158IPR003441NAC domain
PfamPF023656.2E-289132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MKAAALELPP GFRFHPTDEE LVLHYLCRKC TSQSIAVPII AEVDLYKFDP WDLPGMALYG  60
EKEWYFFTPR DRKYPNGSRP NRAAGRGYWK ATGADKPIGQ PKTVGIKKAL VFYAGKAPKG  120
EKTNWIMHEY RLAEVDRSVR KKNSLRLDDW VLCRIHNKKG TIERQGQHLS VKKANSTEIV  180
EEDEKKSVVM LPPPPAPSSA TGTVNDYVYF DTSDSVPRLH TDSSCSEHVV SPEFTCEVQS  240
NPYNYLDATM DIPFTSQFQG DYQMSPLQDM FMYLQKPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-82416411174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2279790.0CU227979.1 Populus EST from severe drought-stressed leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002307447.10.0no apical meristem family protein
SwissprotQ390131e-143NAC2_ARATH; NAC domain-containing protein 2
TrEMBLB9H7H20.0B9H7H2_POPTR; No apical meristem family protein
STRINGPOPTR_0005s20240.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-140NAC family protein